കടല കൊണ്ട് ഇതുപോലെ ഉണ്ടാക്കിയാൽ ഒരാഴ്ചത്തേക്കുള്ള ചായ പലഹാരം റെഡി Crispy Kadala Fry Recipe Malayalam

#anithastastycorner #easykadalafry #kadalafryrecipesmalayalam #kadalafrymalayalamrecipes #easykadalafry #crispykadalafry #kadalarecipesmalayalam #easykadalafrymalayalam #instantkadalafryrecipemalayalam #kadalarecipesmalayalam #nadanrecipes #kadalafryrecipeideas #easykadalafry #kadalarecipesmalayalam #nadanrecipes #eveningrecipes #snackmalayalam #snackrecipesintamil *Crispy Kadala Fry* is a standout snack that captures the beloved texture and spice profile of Kerala street food, making it a perfect, protein-packed treat for any time of day. The process begins with perfectly boiled black chickpeas—often called kala chana or *kadala*—which provide a firm, earthy base. To achieve that signature crunch, the boiled chickpeas are thoroughly dried before being tossed in a vibrant mixture of rice flour, cornstarch, and a bold blend of spices, including Kashmiri chili powder for heat, turmeric for color, and a pinch of asafoetida for depth. When dropped into hot oil, these coated chickpeas transform, becoming irresistibly crispy on the outside while maintaining a satisfying, soft bite within. The final flourish involves tossing the fried chickpeas with a fresh tempering of curry leaves, thinly sliced garlic, and split green chilies sautéed in a little coconut oil. This step is crucial; the aromatic oil coats the crispy chana, infusing it with an unmistakable, authentic fragrance. High in fiber and plant-based protein, this crispy fry is a far superior alternative to processed snacks, offering a crunch that is both nutritious and deeply satisfying. Whether enjoyed with a hot cup of tea or served as a flavorful party appetizer, the combination of the spiced, golden-brown crust and the aromatic curry leaves makes it a truly addictive culinary experience.So do try this recipe at home and drop your comments. #anithastastycorner #easykadalafry #crispykadalafry #kadalarecipesmalayalam #kadalafrymalayalamrecipes #easykadalafry #kadalarecipesmalayalam #easykadafrymalayalamrecipes #kadalarecipesmalayalam #instantkadalafryrecipes #kadalarecipes #chikpearecipesmalayalam #chikpeamalayalamrecipes #easychikpearecipesmalayalam #instantchikpearecipe #chickpeamalayalamrecipes #chikpeafry #chikpearecipesmalayalam #kadalarecipeideas #kadalacurrymalayalamrecipes #kadalafryrecipeideas #easykadalarecipes #kadalarecipesmalayalam #instantkadalafry #kadalafryideasmalayalam #easykadalarecipesmalayalam #nadankadalafry #kadalafryideasmalayalam #crispysnacks #crispysnackmalayalam #instantsnackrecipes #snackideasmalayalam #keralastylekadalafry #kadalafryideas #kadalarecipesmalayalam #crispysnack #easysnackrecipes #instantsnackmalayalam #keralastylesnackideas #eveningrecipes #schoolopening #kidsspecial #karumuru INGRIDIENTS =========== CHIK PEA-300 G SALT WATER GREENCHILLI-5 NOS CURRYLEAVES PEPER-1/4 TSP FENNEL SEED-1 TSP GARLIC-10 NOS KASHMEERI CHILLI POWDER-2 SP GRAM FLOUR-2 SP CORN FLOUR-2 TSP CORINDER POWDER-1/4 TSP