Top Trending Turkish Shawarma With Special Spicy Sauce | ഇത്രയും രുചിയിൽ ഷവർമ കഴിച്ചിട്ടുണ്ടാവില്ല

#Lianskitchen #Malayalamrecipe #Shawarma Hi friends Hope you all are fine😊 Don't forget to like, share and subscribe my channel. my food processor detailed video    • Ramadan Deep Cleaning and Prepreparation|T...   Mail ID for paid collaboration and promotions : [email protected] My Facebook page:    / @lianskitchen   My instagram page: https://instagram.com/_lians_kitchen?... Get ready to experience the legendary flavors of Middle Eastern street food right in your own kitchen with this homemade chicken Shawarma recipe. Marinated in a tantalizing blend of spices, including turmeric, coriander, and smoked paprika, the juicy chicken pieces are cooked to perfection. Slathered with garlic sauce, topped with pickles and fries, and wrapped in soft bread, this Shawarma will transport your taste buds to the bustling streets of the Middle East. Chicken shawarma | shawarma sauce Recipe | turkish shawarma recipe in malayalam | Turkish shawarma | Shawarma | Pearly maaney | Shamis own | Flowers tv | Manorama | Surya | Asianet | Middle East food | Arabian Shawarma | #chichenshawarmarecipe #shawarma #shawarmasauce #whitesauce #redsauce #homemadeshawarma #turkishshawarmarecipeinmalayalam #Chickenwrap #Wrap

Cheesy Garlic Bread | Sesame Chicken in Barbecue Sauce | #Lianskitchen
▶︎

Cheesy Garlic Bread | Sesame Chicken in Barbecue Sauce | #Lianskitchen

Make and Freeze Snacks | Ramadan Special | Bara'th | Cook with  Lian's Kitchen
▶︎

Make and Freeze Snacks | Ramadan Special | Bara'th | Cook with Lian's Kitchen

പാൽചക്ക | ചക്ക സീസണിൽ തീർച്ചയായും പരീക്ഷിക്കേണ്ട നാടൻ റെസിപ്പി 😋 കേരളത്തിന്റെ നാടൻ രുചി
▶︎

പാൽചക്ക | ചക്ക സീസണിൽ തീർച്ചയായും പരീക്ഷിക്കേണ്ട നാടൻ റെസിപ്പി 😋 കേരളത്തിന്റെ നാടൻ രുചി

Al Baik | Saudi's Most Famous Broasted Chicken Recipe | അരമണിക്കൂറിൽ വീട്ടിലുള്ള ചേരുവകൾ കൊണ്ട്
▶︎

Al Baik | Saudi's Most Famous Broasted Chicken Recipe | അരമണിക്കൂറിൽ വീട്ടിലുള്ള ചേരുവകൾ കൊണ്ട്

Outdoor Cooking The Juiciest Steaks with Pineapples!
▶︎

Outdoor Cooking The Juiciest Steaks with Pineapples!

ഒരു അടിപൊളി ചിക്കൻ പൈ | chicken pie recipe in Malayalam | Priscilla's food world in Malayalam
▶︎

ഒരു അടിപൊളി ചിക്കൻ പൈ | chicken pie recipe in Malayalam | Priscilla's food world in Malayalam

Turkish Chicken Doner 50 kg 1 Meter High Kebap Recipe
▶︎

Turkish Chicken Doner 50 kg 1 Meter High Kebap Recipe

Frequency Of God 963 Hz ✨ Attract Miracles, Divine Blessings & Deep Inner Peace In Your Life
▶︎

Frequency Of God 963 Hz ✨ Attract Miracles, Divine Blessings & Deep Inner Peace In Your Life

Nool Parota | Chicken Dhaba Style | ആച്ചിയും ലിയാനയും തിരിച്ചെത്തി
▶︎

Nool Parota | Chicken Dhaba Style | ആച്ചിയും ലിയാനയും തിരിച്ചെത്തി

A Forgotten House Neighbors Hadn’t Seen in DECADES Finally Sees Daylight
▶︎

A Forgotten House Neighbors Hadn’t Seen in DECADES Finally Sees Daylight

Kalyana Biriyani Making | Kozhikkode Dum Biriyani |കല്യാണ ബിരിയാണിയുടെ രഹസ്യം| കോഴിക്കോട് ദംബിരിയാണി
▶︎

Kalyana Biriyani Making | Kozhikkode Dum Biriyani |കല്യാണ ബിരിയാണിയുടെ രഹസ്യം| കോഴിക്കോട് ദംബിരിയാണി

Party Vlog | Restaurant Style Chicken Mandi | Shawaya Chicken | Mango Dessert | Evening Snacks
▶︎

Party Vlog | Restaurant Style Chicken Mandi | Shawaya Chicken | Mango Dessert | Evening Snacks

Ramadan Deep Cleaning and Prepreparation|Time Saving Ideas For Ramadan|Garam masala&Biriyani masala
▶︎

Ramadan Deep Cleaning and Prepreparation|Time Saving Ideas For Ramadan|Garam masala&Biriyani masala

New Jellyfish Aquarium • Healing of Stress, Anxiety and Depressive States • Goodbye Insomnia #30
▶︎

New Jellyfish Aquarium • Healing of Stress, Anxiety and Depressive States • Goodbye Insomnia #30

Homemade Shawarma | Protein Mayonaise  | Al Faham Chicken | Kubs Without Yeast And Baking Powder
▶︎

Homemade Shawarma | Protein Mayonaise | Al Faham Chicken | Kubs Without Yeast And Baking Powder

Restaurant Style Butter Chicken With Butter Naan | Without Thandoor | കിടിലൻ കോമ്പോ 💯
▶︎

Restaurant Style Butter Chicken With Butter Naan | Without Thandoor | കിടിലൻ കോമ്പോ 💯

Rustic Stuffed Potatoes – A Traditional Countryside Recipe 🥔🥩
▶︎

Rustic Stuffed Potatoes – A Traditional Countryside Recipe 🥔🥩

Authentic Chicken Shawarma | Homemade Chicken Shawarma
▶︎

Authentic Chicken Shawarma | Homemade Chicken Shawarma

Chicken Roll | Made by Homemade Sheet | ഈ രഹസ്യം അറിയാതെ പോയല്ലോ😱
▶︎

Chicken Roll | Made by Homemade Sheet | ഈ രഹസ്യം അറിയാതെ പോയല്ലോ😱

ലക്ഷങ്ങൾ ഏറ്റെടുത്ത ചൈനീസ് റൊട്ടിയും ആന്ധ്രാ ചിക്കൻ റോസ്റ്റും | Chinese Roti | Andhra Chicken Roast
▶︎

ലക്ഷങ്ങൾ ഏറ്റെടുത്ത ചൈനീസ് റൊട്ടിയും ആന്ധ്രാ ചിക്കൻ റോസ്റ്റും | Chinese Roti | Andhra Chicken Roast