xqc clips of the gamba goblin
Gamba Gamba Gamba Gamba. If you enjoyed this compilation, don't forget to like, subscribe & comment for more xQc content just like this! ********************************************************* The best protein and gymwear: https://tidd.ly/3C97dHW If you are the original owner of the content viewed in this video, please contact me at [email protected] Please find xQc's socials here: Twitch: / xqcow YouTube: https://www.youtube.com/channel/UCmDT... Twitter: / xqc Instagram: / xqcow1 Reddit: / Discord: / discord Merch: https://metathreads.com/collections/xqc Outro Song: Inova - Disowned Song at 03:04: Casa Bossa Nova You can also find my socials here: / bozzeh10 2nd Channel: / @xqcpepegaclips9610 Submit your clips or suggest your video titles here: https://forms.gle/323aLMFV2haoTTTJA Clip links in order as seen in the video: ********************************************************* 00:00 - / frozencoweringtarocopythis-qq7bgnzavhc5g6vo 00:20 - / patientcogentlegstonelightning-gts-_s4cerj... 00:34 - / exciteddepressedloriskevinturtle-lf2lvsbs1... 01:10 - / distinctfancyfloofdxabomb-asnkgify4crcyimo 01:48 - / bashfulgrosskimchipoooound-zow94qew_-np4qiy 02:08 - / thirstystylishgnatunsane-ggfxxyyqflfffjzm 02:36 - / suavestormyjackaldansgame-yzpwqwyzxz97b0av 02:44 - / sparklingglamorousramennononocat-gkevpx4jp... 02:59 - / glutenfreedepressedmangotebowing-3xqnifbgb... 03:04 - / vastsuavejuiceseemsgood-ezwfroirhfuxv4wu 03:41 - / encouragingmistyminkwutface-foxz0btxtnvk-bs8 04:14 - / rudewittytoadarsonnosexy-72pn9kjcmiunjtrh 04:48 - / brainypowerfuljalapenopjsalt-kkevqupe4dkrxgp- 05:14 - / popularculturedmageresidentsleeper-dp-byoo... 05:22 - / tastyspinelesshabanerorulefive-g1_7pdfjzuc... 05:48 - / belovedsmilingwitchcoolstorybro-eycjucoiut... 05:53 - / quaintalluringoryxritzmitz-0muqh9-euccdamcj 06:29 - / lazydirtyalbatrosswutface-cwrsdb0oo7dlz20e 06:58 - / vibrantephemeraltrayampenergycherry-aknvcz... 07:14 - / livelysolidclampjsugar-ix14qt2tkxbherbw 07:26 - / popularmagnificentmangopartytime-pnwot3tyx... 07:50 - / venomousawkwardmushroommcat-xcftgdwlg_nxe53l 08:16 - / nastyinquisitivebibimbapimglitch-xggcgggpb... 08:32 - / richswisscattlebabyrage-8gg2ta11-i4onfvt 08:50 - / modernvasttriangleargieb8-svylkphq6ei2w_bd 09:01 - / patientbusyturnipnerfredblaster-ymbbax4-kp... 10:00 - / abstemiousshortiguanakreygasm-h4wgysagvy0g... 10:22 - / chillyzanysandstormkapow-ae9nn4ueslt_sxqo 10:46 - / tangentialspunkycucumberklappa-z3o5eiygras... 10:55 (last clip) - / distinctproductivebatteryyouwhy-yrurk1p8lq... ********************************************************* #Bozzeh xQcOW? xQc (Felix Lengyel) is the gaming golem on the Twitch.tv platform. The OW is short to Overwatch. He amasses a following of 5.9M+ on his twitch profile, and his viewership and interactions/impressions reach upto thousands, even millions across all of his social platforms. All his social links can be found in the links section to view xQc's profiles. xQc is the MEGALUL warlock we all know, my favorite label is EL GOBLINO, but other nicknames may be Mr.Cow, The Fart of Twitch, X, xQ Cow, PVC, QVC, HDTV, LMG, PVP etc...He also refers to himself as the gaming golem, warlord of the gaming scene. His early mark on Twitch was due to his popularity on Overwatch, he is a top500 tank main, but he also competed in the Overwatch League for Dallas Fuel and in the Overwatch World Cup with Canada. These days, xQc finds his rhythm by entertaining through variety of games, generally his main game is GTA 5 on the No Pixel server, where xQc represents two different characters, Jean Paul (JP) and Pierre Paul (PP). Other games within variety include Minecraft, Overwatch, Chess, Fortnite, Valorant, CSGO, Simulators, Horror just to name a few!

xqc clips that make you book book book

xqc clips that increase your dopamine level

50 strangers swipe on each other | xQc Reacts

xQc Ai answers questions & is the funniest thing ever

xQc Reacts to WW2 by OverSimplified

xqc clips that are too toxic

Gartic Phone Got Out Of Hand 😂😂

Summit1g Reacts: CSGO Cheaters trolled by fake cheat software 3 by ScriptKid

xqc clips that will make you feel older

xqc clips that won gold at the olympics

xqc clips that slap harder than will smith

xqc clips i can't explain

YouTube's Darkest Rabbit Hole | xQc Reacts

ohnePixel getting Trolled Non Stop

XQC RAGE & DESK SLAM COMPILATION

Dumb and Dumber's great escape from the Police!

xqc clips that will make you cry from laughing

Carson's Viewers Being Funny for 14 Minutes

clips that made xQc famous 6

