കപ്പലണ്ടി കൊണ്ട് ഇതുപോലെ ഉണ്ടാക്കിയാൽ ചായ കടി റെഡി |Kappalandi Masala Fry Recipe Malayalam

#anithastastycorner #easykappalandifry #nilakadalafryrecipesmalayalam #easyrecipesmalayalam #kappalandifryrecipes #easykappalandimasalafry #peanutfryrecipes #peanutfryrecipeideas #easypeanutsnackrecipes #easyrecipesmalayalam Hey, Today we share a Easy Kappalandi Masala Fry Recipe which is very easy and tasty recipe. *Kappalandi Masala Fry* Kappalandi Masala Fry is a popular and flavorful snack enjoyed by people across Kerala. The word "kappalandi" means peanuts in Malayalam, and this dish combines roasted or fried peanuts with a blend of aromatic spices to create a crunchy and tasty treat. It is commonly served as an evening snack, a tea-time accompaniment, or even as a side dish during social gatherings. The preparation is simple yet delicious. Peanuts are first roasted or deep-fried until they become crisp and golden brown. They are then mixed with spices such as chili powder, turmeric powder, black pepper, and a pinch of salt. Some recipes also include curry leaves, garlic, ginger, and finely chopped onions, which enhance the flavor and aroma of the dish. The combination of crunchy peanuts and spicy masala creates a satisfying taste that appeals to all age groups. Kappalandi Masala Fry is not only delicious but also nutritious, as peanuts are a good source of protein, healthy fats, vitamins, and minerals. This snack is affordable, easy to prepare, and widely available in local tea shops and street food stalls throughout Kerala. Its rich flavor, crispy texture, and traditional appeal make Kappalandi Masala Fry a favorite snack that continues to be enjoyed by many people in the region.So do try this recipe at home and drop your comments. #anithastastycorner #kappalandifry #kappalandirecipes #easysnsckrecipes #palaharammalayalam #easypalaharamrecipeideas #nadanpalaharam #keralastylepalaharam #nilakadalai #masalakappalandifry #masalakappalandifryrecipeideas #easykappalamdifryrecipes #kappalansifry #easykappalandifry #kappalandirecipesmalayalam #easysnack #instantsnackrecipesmalayalam #keralastyleeveningsnack #eveningsnackmalayalamrecipes #easyrecipeideas #instantpalaharamrecipes #peanuts #peanutmasalafry #peanutrecipesmalayalam #easypeanutmasalafryrecipes #peanutrecipesmalayalam #nilakadalarecipes #kadalamasalafry #peanutrecipesmalayalam #kadalacurrymalayalamrecipes #kadalafryrecipeideas #easykadalarecipes #kadalarecipesmalayalam #instantkadalafry #kadalafryideasmalayalam #easykadalarecipesmalayalam #nadankadalafry #kadalafryideasmalayalam #crispysnacks #crispysnackmalayalam #instantsnackrecipes #snackideasmalayalam #keralastylekadalafry #kadalafryideas #kadalarecipesmalayalam #crispysnack #easysnackrecipes #instantsnackmalayalam INGRIDIENTS =========== PEANUT-1/2 KG SALT KASHMEERI CHILLI POWDER-2 SP ASAFOETIDA-1/4 TSP GRAM FLOUR-2 SP ROASTED RICE FLOUR-2 SP CUMIN SEED-1/4 TSP CURRYLEAVES GARLIC-10 NOS OIL

ചിക്കൻ പൊരിക്കുമ്പോൾ ഇതുപോലെ പൊരിച്ചു നോക്കൂ എത്ര കഴിച്ചാലും തികയൂല മക്കളെ
▶︎

ചിക്കൻ പൊരിക്കുമ്പോൾ ഇതുപോലെ പൊരിച്ചു നോക്കൂ എത്ര കഴിച്ചാലും തികയൂല മക്കളെ

Frequency Of God 963 Hz ✨ Attract Miracles, Divine Blessings & Deep Inner Peace In Your Life
▶︎

Frequency Of God 963 Hz ✨ Attract Miracles, Divine Blessings & Deep Inner Peace In Your Life

ചക്കക്കുരു മിക്സിയിൽ കറക്കൂ!എത്ര തിന്നാലും മതിയാവില്ല,ചോദിച്ചു വാങ്ങികഴിക്കും!
▶︎

ചക്കക്കുരു മിക്സിയിൽ കറക്കൂ!എത്ര തിന്നാലും മതിയാവില്ല,ചോദിച്ചു വാങ്ങികഴിക്കും!

അതങ്ങനെ കുറേ കൂട്ട്നെസ്സ് വിസർജ്യങ്ങൾ!#kerala
▶︎

അതങ്ങനെ കുറേ കൂട്ട്നെസ്സ് വിസർജ്യങ്ങൾ!#kerala

Ela Ada with banana 😊(966) very soft and tasty 👍
▶︎

Ela Ada with banana 😊(966) very soft and tasty 👍

ഈ തണുപ്പ് കാലത്ത് ഇതുപോലൊന്ന് ഉണ്ടാക്കി വെച്ചോളൂ പനി ജലദോഷം അകറ്റാം Easy Ginger Candy Malayalam
▶︎

ഈ തണുപ്പ് കാലത്ത് ഇതുപോലൊന്ന് ഉണ്ടാക്കി വെച്ചോളൂ പനി ജലദോഷം അകറ്റാം Easy Ginger Candy Malayalam

God Says:"STOP HERE — LISTEN AND HEAR ME SPEAK"/God Message Now/God Message
▶︎

God Says:"STOP HERE — LISTEN AND HEAR ME SPEAK"/God Message Now/God Message

ചക്കക്കുരു മിക്സിയിൽ ഇടൂ വെറും 5 മിനുട്ടിൽ മൊരിഞ്ഞ ചായക്കടി എത്ര കഴിച്ചാലും കൊതി തീരൂലാ മക്കളെ
▶︎

ചക്കക്കുരു മിക്സിയിൽ ഇടൂ വെറും 5 മിനുട്ടിൽ മൊരിഞ്ഞ ചായക്കടി എത്ര കഴിച്ചാലും കൊതി തീരൂലാ മക്കളെ

ഗോതമ്പ് പൊടി ഉണ്ടെങ്കിൽ പെട്ടന്ന് ഉണ്ടാക്കാം | Easy Godhambu Podi Palaharam Recipe Malayalam
▶︎

ഗോതമ്പ് പൊടി ഉണ്ടെങ്കിൽ പെട്ടന്ന് ഉണ്ടാക്കാം | Easy Godhambu Podi Palaharam Recipe Malayalam

COCONUT PAROTTA | Delicious Coconut Shell Beef Paratha Recipe | Cooking In Village
▶︎

COCONUT PAROTTA | Delicious Coconut Shell Beef Paratha Recipe | Cooking In Village

99% പേർക്കും അറിയാത്ത അടുക്കള രഹസ്യമറിഞ്ഞാൽ നിങ്ങൾ ഞെട്ടും Soft Idiyappam#kitchentips #tipsandtricks
▶︎

99% പേർക്കും അറിയാത്ത അടുക്കള രഹസ്യമറിഞ്ഞാൽ നിങ്ങൾ ഞെട്ടും Soft Idiyappam#kitchentips #tipsandtricks

I’m NOT Frying Eggplant Anymore — Few Know This Trick! A Restaurant-Style Eggplant Recipe for Dinner
▶︎

I’m NOT Frying Eggplant Anymore — Few Know This Trick! A Restaurant-Style Eggplant Recipe for Dinner

ബാക്കിയുള്ള ചോറും 1 മുട്ടയും മിക്സിയിൽ കറക്കി പൂ പോലെ പൊറോട്ട ഒക്കെ മാറി നിക്കും
▶︎

ബാക്കിയുള്ള ചോറും 1 മുട്ടയും മിക്സിയിൽ കറക്കി പൂ പോലെ പൊറോട്ട ഒക്കെ മാറി നിക്കും

പപ്പായ കൊണ്ട് ഇങ്ങനെ ഉണ്ടാക്കി നോക്കണേ 😋👌 | Papaya Snack | Keralastyle
▶︎

പപ്പായ കൊണ്ട് ഇങ്ങനെ ഉണ്ടാക്കി നോക്കണേ 😋👌 | Papaya Snack | Keralastyle

കുറഞ്ഞ ചേരുവയിൽ ഒരു മാസത്തേക്കുള്ള ചായ പലഹാരം റെഡി Easy Evening Snack Recipe malayalam
▶︎

കുറഞ്ഞ ചേരുവയിൽ ഒരു മാസത്തേക്കുള്ള ചായ പലഹാരം റെഡി Easy Evening Snack Recipe malayalam

I will never fry potatoes again! This potato snack will impress everyone right away!
▶︎

I will never fry potatoes again! This potato snack will impress everyone right away!

New Jellyfish Aquarium • Healing of Stress, Anxiety and Depressive States • Goodbye Insomnia #30
▶︎

New Jellyfish Aquarium • Healing of Stress, Anxiety and Depressive States • Goodbye Insomnia #30

അന്തസായി തോറ്റു . ഏത് കരാറിനും റെഡി വെറുതെ വിടണമെന്ന് ട്രംപ്
▶︎

അന്തസായി തോറ്റു . ഏത് കരാറിനും റെഡി വെറുതെ വിടണമെന്ന് ട്രംപ്

ഇനി അതിഥികളെ ഞെട്ടിക്കാം 🤩 ഉഗ്രൻ റെസിപ്പി 😋 Bun Recipe
▶︎

ഇനി അതിഥികളെ ഞെട്ടിക്കാം 🤩 ഉഗ്രൻ റെസിപ്പി 😋 Bun Recipe

Stop Frying Eggs the Old Way — This Is the Perfect Poached Egg Method for Beginners | Nancy Home
▶︎

Stop Frying Eggs the Old Way — This Is the Perfect Poached Egg Method for Beginners | Nancy Home