കപ്പലണ്ടി കൊണ്ട് ഇതുപോലെ ഉണ്ടാക്കിയാൽ ചായ കടി റെഡി |Kappalandi Masala Fry Recipe Malayalam

#anithastastycorner #easykappalandifry #nilakadalafryrecipesmalayalam #easyrecipesmalayalam #kappalandifryrecipes #easykappalandimasalafry #peanutfryrecipes #peanutfryrecipeideas #easypeanutsnackrecipes #easyrecipesmalayalam Hey, Today we share a Easy Kappalandi Masala Fry Recipe which is very easy and tasty recipe. *Kappalandi Masala Fry* Kappalandi Masala Fry is a popular and flavorful snack enjoyed by people across Kerala. The word "kappalandi" means peanuts in Malayalam, and this dish combines roasted or fried peanuts with a blend of aromatic spices to create a crunchy and tasty treat. It is commonly served as an evening snack, a tea-time accompaniment, or even as a side dish during social gatherings. The preparation is simple yet delicious. Peanuts are first roasted or deep-fried until they become crisp and golden brown. They are then mixed with spices such as chili powder, turmeric powder, black pepper, and a pinch of salt. Some recipes also include curry leaves, garlic, ginger, and finely chopped onions, which enhance the flavor and aroma of the dish. The combination of crunchy peanuts and spicy masala creates a satisfying taste that appeals to all age groups. Kappalandi Masala Fry is not only delicious but also nutritious, as peanuts are a good source of protein, healthy fats, vitamins, and minerals. This snack is affordable, easy to prepare, and widely available in local tea shops and street food stalls throughout Kerala. Its rich flavor, crispy texture, and traditional appeal make Kappalandi Masala Fry a favorite snack that continues to be enjoyed by many people in the region.So do try this recipe at home and drop your comments. #anithastastycorner #kappalandifry #kappalandirecipes #easysnsckrecipes #palaharammalayalam #easypalaharamrecipeideas #nadanpalaharam #keralastylepalaharam #nilakadalai #masalakappalandifry #masalakappalandifryrecipeideas #easykappalamdifryrecipes #kappalansifry #easykappalandifry #kappalandirecipesmalayalam #easysnack #instantsnackrecipesmalayalam #keralastyleeveningsnack #eveningsnackmalayalamrecipes #easyrecipeideas #instantpalaharamrecipes #peanuts #peanutmasalafry #peanutrecipesmalayalam #easypeanutmasalafryrecipes #peanutrecipesmalayalam #nilakadalarecipes #kadalamasalafry #peanutrecipesmalayalam #kadalacurrymalayalamrecipes #kadalafryrecipeideas #easykadalarecipes #kadalarecipesmalayalam #instantkadalafry #kadalafryideasmalayalam #easykadalarecipesmalayalam #nadankadalafry #kadalafryideasmalayalam #crispysnacks #crispysnackmalayalam #instantsnackrecipes #snackideasmalayalam #keralastylekadalafry #kadalafryideas #kadalarecipesmalayalam #crispysnack #easysnackrecipes #instantsnackmalayalam INGRIDIENTS =========== PEANUT-1/2 KG SALT KASHMEERI CHILLI POWDER-2 SP ASAFOETIDA-1/4 TSP GRAM FLOUR-2 SP ROASTED RICE FLOUR-2 SP CUMIN SEED-1/4 TSP CURRYLEAVES GARLIC-10 NOS OIL